• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> SHP-2 Antibody / PTPN11

SHP-2 Antibody / PTPN11 (R32193)

  Catalog No Formulation Size Price (USD)  
Image R32193 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 439
Bulk quote request
Western blot testing of 1) rat brain, 2) mouse brain, 3) rat heart, 4) mouse kidney, human 5) HeLa, 6) SW620, 7) HepG2 and 8) Jurkat lysate with SHP-2 antibody. Expected/observed molecular weight: ~68 kDa.
IHC testing of FFPE human lung cancer with SHP-2 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
IHC testing of FFPE mouse heart with SHP-2 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
IHC testing of FFPE rat skeletal muscle with SHP-2 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
Availability 1-3 business days
Species Reactivity Human, Mouse, Rat
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
UniProt Q06124
Applications Western Blot : 0.1-0.5ug/ml
IHC (FFPE) : 0.5-1ug/ml
Limitations This SHP-2 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

  • Applications : WB, IHC-P
    Reactivity : Human, Mouse, Rat
    Recrabbitmono
  • Applications : WB, IHC-P, FACS, IF
    Reactivity : Human, Mouse, Rat
  • Applications : WB, IHC-P
    Reactivity : Human
  • Applications : WB
    Reactivity : Human, Mouse, Rat
  • Applications : IF, WB, ELISA
    Reactivity : Human
  • Applications : WB, IHC, FACS, ELISA
    Reactivity : Human
    Pred. Reactivity : Chicken, Mouse, Rat
  • Applications : WB, IHC, ELISA (peptide)
    Reactivity : Human, Mouse
    Pred. Reactivity : Cow, Pig, Rat
  • Applications : WB
    Reactivity : Zebrafish

Description

PTPN11 (Tyrosine-protein phosphatase non-receptor type 11), also known as protein-tyrosine phosphatase 1D (PTP-1D), protein-tyrosine phosphatase 2C (PTP-2C), TYROSINE PHOSPHATASE SHP2 (SHP2), BPTP3, SH-PTP2, SHP-2, SH-PTP3, is an enzyme that in humans is encoded by the PTPN11 gene. PTPN11 is a member of the protein tyrosine phosphatase (PTP) family. The open reading frame consists of 1,779 nucleotides potentially encoding a protein of 593 amino acids with a predicted molecular mass of 68 kD. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP contains two tandem Src homology-2 domains, which function as phospho-tyrosine binding domains and mediate the interaction of this PTP with its substrates. This PTP is widely expressed in most tissues and plays a regulatory role in various cell signaling events that are important for a diversity of cell functions, such as mitogenic activation, metabolic control, transcription regulation, and cell migration. Mutations in this gene are a cause of Noonan syndrome as well as acute myeloid leukemia.

Application Notes

Optimal dilution of the SHP-2 antibody should be determined by the researcher.

Immunogen

Amino acids EKFATLAELVQYYMEHHGQLKEKNGDVIELK of human SHP2/PTPN11 were used as the immunogen for the SHP-2 antibody.

Storage

After reconstitution, the SHP-2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.