RAB14 Antibody (R32156)

Description

RAB14 is a member of the RAB family of small GTPases, which regulate intracellular membrane trafficking. Specifically, RAB14 plays a key role in endocytic recycling and vesicle transport between the Golgi apparatus and early endosomes. It is involved in the sorting and delivery of membrane proteins and lipids, influencing a wide range of cellular processes such as polarity establishment, cytokinesis, and signal transduction.

RAB14 is expressed in multiple tissues and has been implicated in the regulation of glucose transporter trafficking, immune cell function, and epithelial cell polarity. Dysregulation of RAB14 has been associated with metabolic disorders, immune dysfunction, and cancer progression. Its precise control of vesicle dynamics makes it a valuable target for studying intracellular transport and membrane organization.

The RAB14 antibody is a reliable reagent for detecting endogenous RAB14 expression in western blot, immunofluorescence, and immunohistochemistry applications. Researchers use the RAB14 antibody to investigate vesicle trafficking pathways, cellular polarity, and disease mechanisms. With high specificity and consistent performance, the RAB14 antibody is a critical tool for advancing studies in cell biology and pathology.

Application Notes

Optimal dilution of the RAB14 antibody should be determined by the researcher.

Immunogen

Amino acids NKADLEAQRDVTYEEAKQFAEENGLLFLEA of human RAB14 were used as the immunogen for the RAB14 antibody.

Storage

After reconstitution, the RAB14 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.