• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> Villin Antibody / VIL1

Villin Antibody / VIL1 (R31923)

  Catalog No Formulation Size Price (USD)  
Image R31923 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 439
Bulk quote request
Western blot testing of 1) rat intestine, 2) mouse kidney, 3) human RH35, 4) HepG2 and 5) MCF7 lysate with Villin antibody. Expected/observed molecular weight ~93 kDa.
IHC testing of FFPE human intestinal cancer with Villin antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
IHC testing of FFPE mouse intestine with Villin antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
IHC testing of FFPE rat intestine with Villin antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
Immunofluorescent staining of FFPE human ileum with Villin antibody (green) and DAPI (blue). HIER: boil tissue sections in pH6, 10mM citrate buffer, for 20 min and allow to cool before testing.
Immunofluorescent staining of FFPE human colon with Villin antibody (green) and DAPI (blue). HIER: boil tissue sections in pH6, 10mM citrate buffer, for 20 min and allow to cool before testing.
Immunofluorescent staining of FFPE rectal cancer with Villin antibody (green) and DAPI (blue). HIER: boil tissue sections in pH6, 10mM citrate buffer, for 20 min and allow to cool before testing.
Immunofluorescent staining of FFPE mouse intestine with Villin antibody (green) and DAPI (blue). HIER: boil tissue sections in pH6, 10mM citrate buffer, for 20 min and allow to cool before testing.
Immunofluorescent staining of FFPE rat intestine with Villin antibody (green) and DAPI (blue). HIER: boil tissue sections in pH6, 10mM citrate buffer, for 20 min and allow to cool before testing.
Availability 1-3 business days
Species Reactivity Human, Mouse, Rat
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
UniProt P09327
Localization Cytoplasm, luminal membrane of GI tract cells
Applications Western Blot : 0.1-0.5ug/ml
IHC (FFPE) : 0.5-1ug/ml
Immunofluorescence : 2-4ug/ml
Limitations This Villin antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

Description

Villin is known as VIL1. This gene encodes a member of a family of calcium-regulated actin-binding proteins. This protein represents a dominant part of the brush border cytoskeleton which functions in the capping, severing, and bundling of actin filaments. Two mRNAs of 2.7 kb and 3.5 kb have been observed; they result from utilization of alternate poly-adenylation signals present in the terminal exon. In vertebrates, the villin proteins help to support the microfilaments of the microvilli of the brush border. It may play a role in cell plasticity through F-actin severing.

Application Notes

Optimal dilution of the Villin antibody should be determined by the researcher.

Immunogen

Amino acids EQLVNKPVEELPEGVDPSRKEEHLSIEDFT of human Villin were used as the immunogen for the Villin antibody.

Storage

After reconstitution, the Villin antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.