• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> RECK Antibody / Reversion-inducing cysteine-rich protein with Kazal motifs

RECK Antibody / Reversion-inducing cysteine-rich protein with Kazal motifs (RQ4146)

NSJ bio Image Pdf Image
  Catalog No Formulation Size Price (USD)  
Image RQ4146 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 439
Bulk quote request
Western blot testing of human 1) MOLT4 and 2) U-87 MG cell lysate with RECK antibody at 0.5ug/ml. Predicted molecular weight ~106 kDa.
Western blot testing of human 1) MOLT4 and 2) U-87 MG cell lysate with RECK antibody at 0.5ug/ml. Predicted molecular weight ~106 kDa.
Availability 1-3 business days
Species Reactivity Human
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity purified
Buffer Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
UniProt O95980
Applications Western Blot : 0.5-1ug/ml
Limitations This RECK antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

Description

Reversion-inducing-cysteine-rich protein with kazal motifs, also known as RECK, is a human gene, thought to be a metastasis suppressor. The protein encoded by this gene is a cysteine-rich, extracellular protein with protease inhibitor-like domains whose expression is suppressed strongly in many tumors and cells transformed by various kinds of oncogenes. In normal cells, this membrane-anchored glycoprotein may serve as a negative regulator for matrix metalloproteinase-9, a key enzyme involved in tumor invasion and metastasis. Several transcript variants encoding different isoforms have been found for this gene.

Application Notes

Optimal dilution of the RECK antibody should be determined by the researcher.

Immunogen

Amino acids NAQSDQGAMNDMKLWEKGSIKMPFINIPVLDIKKCQPEMWKAIA from the human protein were used as the immunogen for the RECK antibody.

Storage

After reconstitution, the RECK antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Related Products

   1.   View all RECK antibodies

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.