PTPN11 Antibody / SHP2 / Tyrosine-protein phosphatase non-receptor type 11 [clone 2E6] (RQ4920)

Description

Tyrosine-protein phosphatase non-receptor type 11 (PTPN11), also known as SHP2, is a cytoplasmic protein tyrosine phosphatase involved in cell signaling pathways that regulate growth, differentiation, and migration. It contains two SH2 domains that mediate protein-protein interactions and a catalytic domain responsible for its phosphatase activity.

PTPN11 plays a pivotal role in the RAS/MAPK signaling pathway and is essential for normal development and immune function. Mutations in PTPN11 are associated with disorders such as Noonan syndrome, LEOPARD syndrome, and various leukemias. Research on PTPN11 provides valuable insights into both physiological signaling processes and disease pathogenesis.

Using a high-quality PTPN11 antibody enables precise detection in applications including western blot, immunohistochemistry, and immunoprecipitation. A PTPN11 antibody from NSJ Bioreagents offers consistent performance for studies on signal transduction, developmental biology, and oncogenesis. Selecting the right PTPN11 antibody is critical for generating accurate, reproducible, and meaningful research results.

Application Notes

Optimal dilution of the PTPN11 antibody should be determined by the researcher.

Immunogen

Amino acids EKFATLAELVQYYMEHHGQLKEKNGDVIELK from the human protein were used as the immunogen for the PTPN11 antibody.

Storage

After reconstitution, the PTPN11 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.