• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> Pendrin Antibody / SLC26A4

Pendrin Antibody / SLC26A4 (RQ4263)

  Catalog No Formulation Size Price (USD)  
Image RQ4263 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 439
Bulk quote request
Western blot testing of human 1) HK-2 and 2) 293T cell lysate with Pendrin antibody at 0.5ug/ml. Predicted molecular weight ~86 kDa.
Availability 1-3 business days
Species Reactivity Human
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity purified
Buffer Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
UniProt O43511
Localization Membrane
Applications Western Blot : 0.5-1ug/ml
Limitations This Pendrin antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Description

Pendrin is an anion exchange protein that in humans is encoded by the SLC26A4 gene. Pendrin is an ion exchanger found in many types of cells in the body. High levels of pendrin expression have been identified in the inner ear and thyroid. In the thyroid, pendrin mediates a component of the efflux of iodide across the apical membrane of the thyrocyte, which is critical for the formation of thyroid hormone. The exact function of pendrin in the inner ear remains unclear; however, pendrin may play a role in acid-base balance as a chloride-bicarbonate exchanger, regulate volume homeostasis through its ability to function as a chloride-formate exchanger or indirectly modulate the calcium concentration of the endolymph.

Application Notes

Optimal dilution of the Pendrin antibody should be determined by the researcher.

Immunogen

Amino acids RSLRVIVKEFQRIDVNVYFASLQDYVIEKLEQ were used as the immunogen for the Pendrin antibody.

Storage

After reconstitution, the Pendrin antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.