- Tel: 858.663.9055
-
Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
Related Products
|
Paired box gene 8, also known as PAX8, is a protein which in humans is encoded by the PAX8 gene. This gene encodes a member of the paired box (PAX) family of transcription factors. Members of this gene family typically encode proteins that contain a paired box domain, an octapeptide, and a paired-type homeodomain. This nuclear protein is involved in thyroid follicular cell development and expression of thyroid-specific genes. Mutations in this gene have been associated with thyroid dysgenesis, thyroid follicular carcinomas and atypical follicular thyroid adenomas. Alternatively spliced transcript variants encoding different isoforms have been described.
Optimal dilution of the PAX8 antibody should be determined by the researcher.
Amino acids RKHLRTDAFSQHHLEPLECPFERQHYPEAYASPSHTKGEQ from the human protein were used as the immunogen for the PAX8 antibody.
After reconstitution, the PAX8 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.