- Tel: 858.663.9055
-
Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
Related Products
|
Parvin alpha is a protein that in humans is encoded by the PARVA gene. It is located on 11p15.3. PARVA belongs to the parvin family of actin-binding proteins. Parvins are associated with focal contacts and contain calponin homology domains that bind to actin filaments. The encoded protein is part of the integrin-linked kinase signaling complex and plays a role in cell adhesion, motility and survival.
Optimal dilution of the PARVA antibody should be determined by the researcher.
Amino acids QKLQTVLEKINETLKLPPRSIKWNVDSVHAK of human Parvin alpha were used as the immunogen for the PARVA antibody.
After reconstitution, the PARVA antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.