- Tel: 858.663.9055
-
Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
Related Products
|
Matrix metallopeptidase 9, or 92 kDa type IV collagenase, is part of a family of proteins involved in the breakdown of extracellular matrix in normal physiological processes. Most MMPs are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. MMP9 degrades type IV and V collagens.
Optimal dilution of the MMP9 antibody should be determined by the researcher.
Amino acids KALLFSKGRVWRFDLKSQKVDPQSVIRVDKEF of mouse MMP9 were used as the immunogen for the MMP9 antibody.
After reconstitution, the MMP9 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.