• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> LMO2 Antibody / Rhombotin 2

LMO2 Antibody / Rhombotin 2 (RQ4423)

  Catalog No Formulation Size Price (USD)  
Image RQ4423 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 439
Bulk quote request
Western blot testing of human 1) placenta, 2) SMMC-7721, 3) A375 and 4 A431 lysate with LMO2 antibody at 0.5ug/ml. Predicted molecular weight ~18 kDa (isoform 1), ~25 kDa (isoform 3).
Western blot testing of 1) rat C6 and 2) mouse Neuro-2a lysate with LMO2 antibody at 0.5ug/ml. Predicted molecular weight ~18 kDa (isoform 1), ~25 kDa (isoform 3).
Availability 1-3 business days
Species Reactivity Human, Mouse, Rat
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity purified
Buffer Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
UniProt P25791
Applications Western Blot : 0.5-1ug/ml
Limitations This LMO2 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

Description

LIM domain only 2 (Rhombotin-like 1, Rhombotin 2), also known as LMO2, RBTNL1, RBTN2, RHOM2, TTG2, and T-Cell Translocation Protein 2, is a protein which in humans is encoded by the LMO2 gene. LMO2 encodes a cysteine-rich, two LIM-domain protein that is required for yolk sac erythropoiesis. The LMO2 protein has a central and crucial role in hematopoietic development and is highly conserved. The LMO2 transcription start site is located approximately 25 kb downstream from the 11p13 T-cell translocation cluster (11p13 ttc), where a number T-cell acute lymphoblastic leukemia-specific translocations occur. Alternative splicing results in multiple transcript variants encoding different isoforms.

Application Notes

Optimal dilution of the LMO2 antibody should be determined by the researcher.

Immunogen

Amino acids QKHFCVGDRYLLINSDIVCEQDIYEWTKINGMI from the human protein were used as the immunogen for the LMO2 antibody.

Storage

After reconstitution, the LMO2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.