• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> IL7R Antibody / CD127

IL7R Antibody / CD127 (R32384)

  Catalog No Formulation Size Price (USD)  
Image R32384 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 439
Bulk quote request
Western blot testing of human 22RV1 cell lysate with IL7R antibody. Predicted molecular weight: ~51/60-90 kDa (unmodified/glycosylated).
Flow cytometry testing of human U-2 OS cells with IL7R antibody at 1ug/10^6 cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= IL7R antibody.
Availability 1-3 business days
Species Reactivity Human
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
UniProt P16871
Applications Western Blot : 0.1-0.5ug/ml
Flow Cytometry : 1-3ug/10^6 cells
Limitations This IL7R antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

Description

The interleukin-7 receptor, also known as IL7R alpha, is a protein found on the surface of cells. It is mapped to 5p13. Interleukin-7 receptor has been shown to play a critical role in the development of immune cells called lymphocytes - specifically in a process known as V(D)J recombination. This protein is also found to control the accessibility of a region of the genome that contains the T-cell receptor gamma gene, by STAT5 and histone acetylation. Knockout studies in mice suggest that blocking apoptosis is an essential function of this protein during differentiation and activation of T lymphocytes. Functional defects in this protein may be associated with the pathogenesis of severe combined immunodeficiency (SCID).

Immunogen

Amino acids DHKKTLEHLCKKPRKNLNVSFNPESFLDCQIHRVDDIQ from IL7R alpha were used as the immunogen for the IL7R antibody.

Storage

After reconstitution, the IL7R antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.