• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> IBA1 Antibody / AIF-1

IBA1 Antibody / AIF-1 (R32736)

  Catalog No Formulation Size Price (USD)  
Image R32736 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 439
Bulk quote request
IHC testing of FFPE human spleen tissue with IBA1 antibody. Required HIER: steam section in pH8 EDTA buffer for 20 min and allow to cool prior to testing.
Western blot testing of human 1) HEL and 2) ThP-1 cell lysate with IBA1 antibody. Predicted molecular weight ~17 kDa.
Availability 1-3 business days
Species Reactivity Human
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2% Trehalose
UniProt P55008
Localization Cytoplasmic, membranous
Applications Western Blot : 0.5-1ug/ml
Immunohistochemistry (FFPE) : 2-5ug/ml
Limitations This IBA1 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

Description

Allograft inflammatory factor 1 (AIF-1), also known as ionized calcium-binding adapter molecule 1 (IBA1), is a protein that in humans is encoded by the AIF1 gene. This gene encodes a protein that binds actin and calcium. And this gene is induced by cytokines and interferon and may promote macrophage activation and growth of vascular smooth muscle cells and T-lymphocytes. Polymorphisms in this gene may be associated with systemic sclerosis. Alternative splicing results in multiple transcript variants, but the full-length and coding nature of some of these variants is not certain.

Application Notes

Optimal dilution of the IBA1 antibody should be determined by the researcher.

Immunogen

Amino acids 99-133 (ETFSYPDFLRMMLGKRSAILKMILMYEEKAREKEK) from the human protein were used as the immunogen for the IBA1 antibody.

Storage

After reconstitution, the IBA1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.