• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> HMGB1 Antibody

HMGB1 Antibody (R32675)

  Catalog No Formulation Size Price (USD)  
Image R32675 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 439
Bulk quote request
Western blot testing of 1) rat brain, 2) mouse ovary, 3) human 22RV1 and 4) human HeLa lysate with HMGB1 antibody at 0.5ug/ml. Predicted molecular weight ~25 kDa.
IHC testing of FFPE human breast cancer tissue with HMGB1 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
IHC testing of FFPE human placental tissue with HMGB1 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
IHC testing of FFPE mouse intestinal tissue with HMGB1 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
IHC testing of FFPE mouse liver tissue with HMGB1 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
IHC testing of FFPE rat intestinal tissue with HMGB1 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
IHC testing of FFPE rat liver tissue with HMGB1 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
Availability 1-3 business days
Species Reactivity Human, Mouse, Rat
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide
UniProt P09429
Localization Nuclear
Applications Western Blot : 0.5-1ug/ml
IHC (FFPE) : 1-2ug/ml
Limitations This HMGB1 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

  • Applications : WB
    Reactivity : Human, Mouse
  • Applications : IHC, WB, ELISA
    Reactivity : Human, Mouse
    Pred. Reactivity : Rat, Bovine, Pig, Primate, Hamster
  • Applications : IHC-P, WB
    Reactivity : Human, Rat
    Rab Mono Image
  • Applications : WB, FACS, IHC-P
    Reactivity : Human, Mouse, Rat, Monkey
  • Applications : WB, ELISA
    Reactivity : Human
    Pred. Reactivity : Primate
  • Applications : WB, ELISA
    Reactivity : Human
    Pred. Reactivity : Mouse, Rat, Bovine, Pig, Primate, Hamster
  • Applications : IHC-P, WB
    Reactivity : Zebrafish

Description

High mobility group box 1 protein, also known as high-mobility group protein 1 (HMG-1) and amphoterin, is a protein that in humans is encoded by the HMGB1 gene. This gene encodes a protein that belongs to the High Mobility Group-box superfamily. The encoded non-histone, nuclear DNA-binding protein regulates transcription, and is involved in organization of DNA. This protein plays a role in several cellular processes, including inflammation, cell differentiation and tumor cell migration. Multiple pseudogenes of this gene have been identified. Alternative splicing results in multiple transcript variants that encode the same protein.

Application Notes

Optimal dilution of the HMGB1 antibody should be determined by the researcher.

Immunogen

Amino acids 124-154 (DVAKKLGEMWNNTAADDKQPYEKKAAKLKEK) from the human protein were used as the immunogen for the HMGB1 antibody.

Storage

After reconstitution, the HMGB1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.