- Tel: 858.663.9055
-
Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
Related Products
|
Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated ion channel 2 is a protein that in humans is encoded by the HCN2 gene. The HCN2 gene is localized on human chromosome 19p13.3 and contains eight exons spanning approximately 27 kb. Hyperpolarization-activated cation channels of the HCN gene family, such as HCN2, contribute to spontaneous rhythmic activity in both heart and brain.
Optimal dilution of the HCN2 antibody should be determined by the researcher.
Amino acids 682-714 (VFNNQENAIIQEIVKYDREMVQQAELGQRVGLF) from the human protein were used as the immunogen for the HCN2 antibody.
After reconstitution, the HCN2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.