• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> FGB Antibody / Fibrinogen beta chain

FGB Antibody / Fibrinogen beta chain [clone 6D12] (RQ6233)

  Catalog No Formulation Size Price (USD)  
Image RQ6233 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 439
Bulk quote request
IHC staining of FFPE human liver cancer with FGB antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
Western blot testing of human HepG2 cell lysate with FGB antibody. Predicted molecular weight ~56 kDa.
Availability 1-3 business days
Species Reactivity Human
Format Antigen affinity purified
Clonality Monoclonal (mouse origin)
Isotype Mouse IgG2b
Clone Name 6D12
Purity Affinity purified
Buffer Lyophilized from 1X PBS with 2% Trehalose
UniProt P02675
Applications Western Blot : 1-2ug/ml
Immunohistochemistry (FFPE) : 2-5ug/ml
Limitations This FGB antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

Description

Fibrinogen beta chain, mapped to 4q31.3, is also known as FGB. The protein encoded by this gene is the beta component of fibrinogen, a blood-borne glycoprotein comprised of three pairs of nonidentical polypeptide chains. Following vascular injury, fibrinogen is cleaved by thrombin to form fibrin which is the most abundant component of blood clots. In addition, various cleavage products of fibrinogen and fibrin regulate cell adhesion and spreading, display vasoconstrictor and chemotactic activities, and are mitogens for several cell types. Mutations in this gene lead to several disorders, including afibrinogenemia, dysfibrinogenemia, hypodysfibrinogenemia and thrombotic tendency. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Application Notes

Optimal dilution of the FGB antibody should be determined by the researcher.

Immunogen

Amino acids TNLRVLRSILENLRSKIQKLESDVSAQMEYCRT from the human protein were used as the immunogen for the FGB antibody.

Storage

After reconstitution, the FGB antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.