- Tel: 858.663.9055
-
Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
Related Products
|
Endoglin (Osler-Rendu-Weber syndrome 1), also called CD105, is a type I membrane glycoprotein located on cell surfaces and is a part of the TGF beta receptor complex. Its gene is mapped to human chromosome 8. The protein consists of a homodimer of 180 kDA with disulfide links. It has been found on endothelial cells, activated macrophages, fibroblasts and smooth muscle cells. Endoglin has a role in the development of the cardiovascular system and in vascular remodeling and has been found to be elevated in pregnant women who subsequently develop preeclampsia.
Optimal dilution of the Endoglin antibody should be determined by the researcher.
Amino acids 258-297 (YVSWLIDANHNMQIWTTGEYSFKIFPEKNIRGFKLPDTPQ) from the human protein were used as the immunogen for the Endoglin antibody.
After reconstitution, the Endoglin antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.