• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> Endoglin Antibody / CD105

Endoglin Antibody / CD105 (R32690)

  Catalog No Formulation Size Price (USD)  
Image R32690 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 439
Bulk quote request
Flow cytometry testing of human U-87 MG cells with Endoglin antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= Endoglin antibody.
Western blot testing of human 1) SiHa and 2) HeLa cell lysate with Endoglin antibody. Observed molecular weight: 70/90 kDa (monomer, unmodified/glycosylated); 140-180 kDa (dimer, unmodified/glycosylated).
Availability 1-3 business days
Species Reactivity Human
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2% Trehalose
UniProt P17813
Applications Western Blot : 0.5-1ug/ml
Flow Cytometry : 1-3ug/million cells
Limitations This Endoglin antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

Description

Endoglin (Osler-Rendu-Weber syndrome 1), also called CD105, is a type I membrane glycoprotein located on cell surfaces and is a part of the TGF beta receptor complex. Its gene is mapped to human chromosome 8. The protein consists of a homodimer of 180 kDA with disulfide links. It has been found on endothelial cells, activated macrophages, fibroblasts and smooth muscle cells. Endoglin has a role in the development of the cardiovascular system and in vascular remodeling and has been found to be elevated in pregnant women who subsequently develop preeclampsia.

Application Notes

Optimal dilution of the Endoglin antibody should be determined by the researcher.

Immunogen

Amino acids 258-297 (YVSWLIDANHNMQIWTTGEYSFKIFPEKNIRGFKLPDTPQ) from the human protein were used as the immunogen for the Endoglin antibody.

Storage

After reconstitution, the Endoglin antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.