• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Order
Home >> Antibodies >> DC-SIGN Antibody / CD209

DC-SIGN Antibody / CD209 (RQ4179)

NSJ bio Image Pdf Image
  Catalog No Formulation Size Price (USD)  
Image RQ4179 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 439
Bulk quote request
IHC staining of FFPE human spleen tissue with DC-SIGN antibody, HRP-secondary and DAB substrate. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
›
IHC staining of FFPE human spleen tissue with DC-SIGN antibody, HRP-secondary and DAB substrate. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human placental tissue with DC-SIGN antibody, HRP-secondary and DAB substrate. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
Western blot testing of human HepG2 cell lysate with DC-SIGN antibody at 0.5ug/ml. Predicted molecular weight ~46 kDa.
Western blot testing of human ThP-1 cell lysate with DC-SIGN antibody at 0.5ug/ml. Predicted molecular weight ~46 kDa.
Availability 1-3 business days
Species Reactivity Human
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity purified
Buffer Lyophilized from 1X PBS with 2% Trehalose
UniProt Q9NNX6
Localization Cell membrane, secreted
Applications Western Blot : 0.5-1ug/ml
Immunohistochemistry (FFPE) : 2-5ug/ml
Limitations This DC-SIGN antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

Description

DC-SIGN (CD209) is a type II transmembrane C-type lectin receptor expressed mainly on dendritic cells and some macrophages. It functions as a pathogen-recognition receptor, binding to high-mannose glycans and fucose-containing ligands on viruses, bacteria, and parasites. DC-SIGN plays a key role in pathogen capture, antigen presentation, and immune modulation.

Beyond microbial recognition, DC-SIGN interacts with host glycoproteins to regulate immune signaling and tolerance. Dysregulation of DC-SIGN activity has been implicated in viral pathogenesis, chronic inflammation, and cancer immune evasion. Its role in bridging innate and adaptive immunity makes it an important target in immunology and infectious disease research.

Using a high-quality DC-SIGN antibody allows for reliable detection in applications such as flow cytometry, immunohistochemistry, and western blot. A DC-SIGN antibody from NSJ Bioreagents ensures sensitivity and reproducibility for studies on dendritic cell biology, pathogen-host interactions, and immune signaling. Selecting the right DC-SIGN antibody is essential for generating accurate and consistent results.

Application Notes

Optimal dilution of the DC-SIGN antibody should be determined by the researcher.

Immunogen

Amino acids MSDSKEPRLQQLGLLEEEQLRGLGFRQTRGYKSLA were used as the immunogen for the DC-SIGN antibody.

Storage

After reconstitution, the DC-SIGN antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Related Products

   1.   View all DC-SIGN antibodies

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.