- Tel: 858.663.9055
- 
									 Email: info@nsjbio.com Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
 Email: info@nsjbio.com
Email: info@nsjbio.com
								Related Products
| 
 | 
Bone morphogenetic protein 5 is a protein that in humans is encoded by the BMP5 gene. This gene encodes a member of the bone morphogenetic protein family which is part of the transforming growth factor-beta superfamily. The superfamily includes large families of growth and differentiation factors. Bone morphogenetic proteins were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. These proteins are synthesized as prepropeptides, cleaved, and then processed into dimeric proteins. And this protein may act as an important signaling molecule within the trabecular meshwork and optic nerve head, and may play a potential role in glaucoma pathogenesis. This gene is differentially regulated during the formation of various tumors.
Optimal dilution of the BMP5 antibody should be determined by the researcher.
Amino acids HQDSSRMSSVGDYNTSEQKQACKKHELYVSFRDL of human BMP5 were used as the immunogen for the BMP5 antibody.
After reconstitution, the BMP5 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
 
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.