- Tel: 858.663.9055
-
Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
BDKRB2 antibody is a valuable reagent for studying vascular biology, inflammation, and G protein-coupled receptor (GPCR) signaling. The encoded protein, B2 bradykinin receptor, is a constitutively expressed GPCR that binds bradykinin, a peptide mediator involved in vasodilation, vascular permeability, and pain sensation. Unlike the inducible B1 receptor, BDKRB2 is widely expressed under physiological conditions in endothelial cells, smooth muscle, and various tissues, where it mediates most of the acute effects of bradykinin on the cardiovascular and inflammatory systems.
Activation of the B2 bradykinin receptor triggers intracellular signaling cascades, including phospholipase C activation, inositol trisphosphate (IP3) generation, and calcium mobilization. These pathways lead to smooth muscle relaxation, nitric oxide release, and prostacyclin production, all of which contribute to vasodilation and maintenance of vascular tone. Through these mechanisms, BDKRB2 is a critical regulator of blood pressure, microcirculation, and endothelial barrier integrity.
Beyond vascular control, BDKRB2 plays key roles in inflammation and pain. Bradykinin signaling through this receptor promotes edema, leukocyte recruitment, and sensitization of nociceptors. Dysregulation of BDKRB2 activity has been implicated in pathological conditions such as hereditary angioedema, asthma, hypertension, and chronic pain syndromes. Because of its involvement in these pathways, the B2 bradykinin receptor has been explored as a therapeutic target in cardiovascular, inflammatory, and pain-related diseases.
At the molecular level, BDKRB2 is a seven-transmembrane receptor that couples to Gq proteins to stimulate phosphoinositide hydrolysis and calcium signaling. It can also engage Gi proteins and activate MAPK pathways, linking it to cell proliferation and survival. Receptor desensitization and internalization are tightly regulated by phosphorylation and interaction with beta-arrestins, mechanisms that modulate receptor responsiveness during sustained stimulation.
The BDKRB2 antibody is widely used in western blotting, immunohistochemistry, immunofluorescence, and flow cytometry to study receptor expression, localization, and regulation. These applications are important for research in vascular physiology, inflammation, and drug development. For scientists investigating GPCR signaling, endothelial biology, or therapeutic intervention strategies, the BDKRB2 antibody provides a reliable detection tool. NSJ Bioreagents offers validated antibodies that ensure reproducibility and accuracy in advanced molecular studies.
Differences in protocols and secondary/substrate sensitivity may require the BDKRB2 antibody to be titrated for optimal performance.
Amino acids 357-391 (RSEPIQMENSMGTLRTSISVERQIHKLQDWAGSRQ) from the human protein were used as the immunogen for the BDKRB2 antibody.
After reconstitution, the BDKRB2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.