• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> 12 Lipoxygenase Antibody / ALOX12

12 Lipoxygenase Antibody / ALOX12 (R32691)

  Catalog No Formulation Size Price (USD)  
Image R32691 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 439
Bulk quote request
Western blot testing of 1) rat spleen and 2) mouse spleen lysate with 12 Lipoxygenase antibody at 0.5ug/ml. Predicted molecular weight ~76 kDa.
Availability 1-3 business days
Species Reactivity Mouse, Rat
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2% Trehalose
UniProt P18054
Applications Western Blot : 0.5-1ug/ml
Limitations This 12 Lipoxygenase antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

Description

ALOX12 (Arachidonate 12-lipoxygenase) is an enzyme that in humans is encoded by the ALOX12 gene. By fluorescence in situ hybridization, the gene is located in band 17p13.1. The gene consists of 14 exons with 13 introns and spans approximately 15 kb of DNA Arachidonate 12-lipoxygenase introduces a molecular oxygen into the C-12 position of arachidonic acid to produce 12(S)-hydroperoxy-5,8,10,14-eicosatetraenoic acid. The major pathway of arachidonic acid metabolism in human platelets proceeds via a 12-lipoxygenase enzyme. Expression of the LOG12 gene was detected in human erythroleukemia cells, platelets, and human umbilical vein endothelial cells by reverse transcription-PCR analysis.

Application Notes

Optimal dilution of the 12 Lipoxygenase antibody should be determined by the researcher.

Immunogen

Amino acids 186-231 (ALKRVYTLLSSWNCLEDFDQIFWGQKSALAEKVRQCWQDDELFSYQ) were used as the immunogen for the 12 Lipoxygenase antibody.

Storage

After reconstitution, the 12 Lipoxygenase antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.